Class a: All alpha proteins [46456] (289 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.11: RNA polymerase subunit RPB10 [46924] (1 family) automatically mapped to Pfam PF01194 |
Family a.4.11.1: RNA polymerase subunit RPB10 [46925] (2 proteins) Zn-binding site is near the N-terminus |
Protein RNA polymerase subunit RPB10 [46926] (3 species) |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [63490] (28 PDB entries) Uniprot P22139; part of multichain biological unit |
Domain d2ja7j1: 2ja7 J:1-65 [138203] Other proteins in same PDB: d2ja7a1, d2ja7b1, d2ja7c1, d2ja7c2, d2ja7d1, d2ja7e1, d2ja7e2, d2ja7f1, d2ja7g1, d2ja7g2, d2ja7h1, d2ja7i1, d2ja7i2, d2ja7k1, d2ja7l1, d2ja7m1, d2ja7n1, d2ja7o1, d2ja7o2, d2ja7p1, d2ja7q1, d2ja7q2, d2ja7r1, d2ja7s1, d2ja7s2, d2ja7t1, d2ja7u1, d2ja7u2, d2ja7w1, d2ja7x1 automatically matched to d1i3qj_ protein/DNA complex; protein/RNA complex; complexed with mg, zn |
PDB Entry: 2ja7 (more details), 3.8 Å
SCOPe Domain Sequences for d2ja7j1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ja7j1 a.4.11.1 (J:1-65) RNA polymerase subunit RPB10 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} mivpvrcfscgkvvgdkwesylnllqedeldegtalsrlglkryccrrmilthvdliekf lrynp
Timeline for d2ja7j1:
View in 3D Domains from other chains: (mouse over for more information) d2ja7a1, d2ja7b1, d2ja7c1, d2ja7c2, d2ja7d1, d2ja7e1, d2ja7e2, d2ja7f1, d2ja7g1, d2ja7g2, d2ja7h1, d2ja7i1, d2ja7i2, d2ja7k1, d2ja7l1, d2ja7m1, d2ja7n1, d2ja7o1, d2ja7o2, d2ja7p1, d2ja7q1, d2ja7q2, d2ja7r1, d2ja7s1, d2ja7s2, d2ja7t1, d2ja7u1, d2ja7u2, d2ja7v1, d2ja7w1, d2ja7x1 |