SCOPe 2.08: Domain d2ja6g2: 2ja6 G:1-80

Lineage for d2ja6g2 (2ja6 G:1-80)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.230: Dodecin subunit-like [88797] (9 superfamilies)
   beta-alpha-beta(2); 2 layers: alpha/beta; antiparallel beta-sheet: order 132

4. Superfamily d.230.1: N-terminal, heterodimerisation domain of RBP7 (RpoE) [88798] (3 families)
   automatically mapped to Pfam PF03876

5. Family d.230.1.1: N-terminal, heterodimerisation domain of RBP7 (RpoE) [88799] (1 protein)

6. Protein N-terminal, heterodimerisation domain of RBP7 (RpoE) [88800] (4 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [117777] (6 PDB entries)
   Uniprot P34087

8. Domain d2ja6g2: 2ja6 G:1-80 [138183]
   Other proteins in same PDB: d2ja6a1, d2ja6b1, d2ja6c1, d2ja6c2, d2ja6d1, d2ja6e1, d2ja6e2, d2ja6f1, d2ja6g1, d2ja6h1, d2ja6i1, d2ja6i2, d2ja6j1, d2ja6k1, d2ja6l1
   automatically matched to d1y14b2
   protein/DNA complex; protein/RNA complex; complexed with mg, zn

Details for d2ja6g2

PDB Entry: 2ja6, 4 Å

PDB Description: cpd lesion containing rna polymerase ii elongation complex b

PDB Compounds: (G:) DNA-directed RNA polymerase II 19kda polypeptide

SCOPe Domain Sequences for d2ja6g2:

Sequence; same for both SEQRES and ATOM records:

>d2ja6g2 d.230.1.1 (G:1-80) N-terminal, heterodimerisation domain of RBP7 (RpoE) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
mffikdlslnitlhpsffgprmkqylktklleevegsctgkfgyilcvldydnidiqrgr
ilptdgsaefnvkyravvfk

Timeline for d2ja6g2:

• d2ja6g2 first appeared in SCOP 1.73
  
• d2ja6g2 appears in SCOPe 2.07