SCOP 1.73: Domain d2ja6e2: 2ja6 E:144-215

Lineage for d2ja6e2 (2ja6 E:144-215)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.78: RPB5-like RNA polymerase subunit [55286] (1 superfamily)
   core: beta-alpha-beta-alpha-beta(2); 2 layers, alpha/beta

4. Superfamily d.78.1: RPB5-like RNA polymerase subunit [55287] (1 family)

5. Family d.78.1.1: RPB5 [55288] (2 proteins)

6. Protein Eukaryotic RPB5 C-terminal domain [55292] (1 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [55293] (25 PDB entries)

8. Domain d2ja6e2: 2ja6 E:144-215 [138180]
   Other proteins in same PDB: d2ja6a1, d2ja6b1, d2ja6c1, d2ja6c2, d2ja6d1, d2ja6e1, d2ja6f1, d2ja6g1, d2ja6g2, d2ja6h1, d2ja6i1, d2ja6i2, d2ja6j1, d2ja6k1, d2ja6l1
   automatically matched to d1dzfa2
   complexed with bru, mg, tt, zn

Details for d2ja6e2

PDB Entry: 2ja6, 4 Å

PDB Description: cpd lesion containing rna polymerase ii elongation complex b

PDB Compounds: (E:) DNA-directed RNA polymerases I, II, and III 27 kDa polypeptide

SCOP Domain Sequences for d2ja6e2:

Sequence; same for both SEQRES and ATOM records:

>d2ja6e2 d.78.1.1 (E:144-215) Eukaryotic RPB5 C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
ithhelvpkhirlssdekrellkryrlkesqlpriqradpvalylglkrgevvkiirkse
tsgryasyricm

Timeline for d2ja6e2:

• d2ja6e2 is new in SCOP 1.73
  
• d2ja6e2 appears in SCOP 1.75
  
• d2ja6e2 appears in the current release, SCOPe 2.08