SCOPe 2.02: Domain d2j8xd_: 2j8x D:

Lineage for d2j8xd_ (2j8x D:)

1. Root: SCOPe 2.02

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.17: Cystatin-like [54402] (7 superfamilies)
   Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet

4. Superfamily d.17.5: Uracil-DNA glycosylase inhibitor protein [54441] (1 family)
   has an additional strand at the C-terminus and a helix inserted after the first strand

5. Family d.17.5.1: Uracil-DNA glycosylase inhibitor protein [54442] (1 protein)

6. Protein Uracil-DNA glycosylase inhibitor protein [54443] (2 species)

7. Species Bacteriophage pbs2 [TaxId:10684] [54445] (10 PDB entries)

8. Domain d2j8xd_: 2j8x D: [138144]
   Other proteins in same PDB: d2j8xa1, d2j8xc1
   automated match to d1lqmh_
   protein/DNA complex; complexed with ure

Details for d2j8xd_

PDB Entry: 2j8x, 2.3 Å

PDB Description: epstein-barr virus uracil-dna glycosylase in complex with ugi from pbs-2

PDB Compounds: (D:) uracil-DNA glycosylase inhibitor

SCOPe Domain Sequences for d2j8xd_:

Sequence; same for both SEQRES and ATOM records:

>d2j8xd_ d.17.5.1 (D:) Uracil-DNA glycosylase inhibitor protein {Bacteriophage pbs2 [TaxId: 10684]}
lsdiieketgkqlviqesilmlpeeveevignkpesdilvhtaydestdenvmlltsdap
eykpwalviqdsngenkikml

Timeline for d2j8xd_:

• d2j8xd_ first appeared in SCOP 1.73, called d2j8xd1
  
• d2j8xd_ appears in SCOPe 2.01
  
• d2j8xd_ appears in SCOPe 2.03
  
• d2j8xd_ appears in the current release, SCOPe 2.08