SCOPe 2.07: Domain d2j8ka1: 2j8k A:2-175

Lineage for d2j8ka1 (2j8k A:2-175)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.80: Single-stranded right-handed beta-helix [51125] (8 superfamilies)
   superhelix turns are made of parallel beta-strands and (short) turns

4. Superfamily b.80.8: Pentapeptide repeat-like [141571] (2 families)
   superhelix turns are made of four short strands each; duplication: the sequence pentapeptide repeats correspond to individual strands

5. Family b.80.8.1: Pentapeptide repeats [141572] (4 proteins)
   Pfam PF00805 (covers eight repeats or two full superhelical turns)
   this is a repeat family; one repeat unit is 2bm4 A:81-101 found in domain

6. Protein NP275-NP276 [141575] (1 species)
   Two consecuitive ORFs in the same frame that maintain the sequence periodicity; probable single ORF disrupted by the nonsense mutation

7. Species Nostoc punctiforme [TaxId:272131] [141576] (2 PDB entries)

8. Domain d2j8ka1: 2j8k A:2-175 [138141]
   Other proteins in same PDB: d2j8ka2
   'Fusion form' produced by the mutation of the intervening stop codon
   complexed with mes, so4

Details for d2j8ka1

PDB Entry: 2j8k, 1.5 Å

PDB Description: structure of the fusion of np275 and np276, pentapeptide repeat proteins from nostoc punctiforme

PDB Compounds: (A:) np275-np276

SCOPe Domain Sequences for d2j8ka1:

Sequence; same for both SEQRES and ATOM records:

>d2j8ka1 b.80.8.1 (A:2-175) NP275-NP276 {Nostoc punctiforme [TaxId: 272131]}
dveklrqlyaagerdfsivdlrgavleninlsgailhgamldeanlqqanlsradlsgat
lngadlrganlskadlsdaildnailegaildeavlnqanlkaanleqailshaniread
lseanleaadlsgadlaiadlhqanlhqaaleranltganledanlegtilegg

Timeline for d2j8ka1:

• d2j8ka1 first appeared in SCOP 1.73
  
• d2j8ka1 appears in SCOPe 2.06
  
• d2j8ka1 appears in the current release, SCOPe 2.08