Class b: All beta proteins [48724] (178 folds) |
Fold b.80: Single-stranded right-handed beta-helix [51125] (8 superfamilies) superhelix turns are made of parallel beta-strands and (short) turns |
Superfamily b.80.8: Pentapeptide repeat-like [141571] (2 families) superhelix turns are made of four short strands each; duplication: the sequence pentapeptide repeats correspond to individual strands |
Family b.80.8.1: Pentapeptide repeats [141572] (4 proteins) Pfam PF00805 (covers eight repeats or two full superhelical turns) this is a repeat family; one repeat unit is 2bm4 A:81-101 found in domain |
Protein NP275-NP276 [141575] (1 species) Two consecuitive ORFs in the same frame that maintain the sequence periodicity; probable single ORF disrupted by the nonsense mutation |
Species Nostoc punctiforme [TaxId:272131] [141576] (2 PDB entries) |
Domain d2j8ia1: 2j8i A:2-98 [138139] Other proteins in same PDB: d2j8ia2, d2j8ib3 'Truncated form', NP275 only complexed with cl |
PDB Entry: 2j8i (more details), 2.1 Å
SCOPe Domain Sequences for d2j8ia1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2j8ia1 b.80.8.1 (A:2-98) NP275-NP276 {Nostoc punctiforme [TaxId: 272131]} dveklrqlyaagerdfsivdlrgavleninlsgailhgamldeanlqqanlsradlsgat lngadlrganlskadlsdaildnailegaildeavln
Timeline for d2j8ia1: