Lineage for d2j88l2 (2j88 L:109-205)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 651988Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 654118Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 655938Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (3 species)
  7. 656129Species Mouse (Mus musculus) [TaxId:10090] [88567] (311 PDB entries)
  8. 656343Domain d2j88l2: 2j88 L:109-205 [138138]
    Other proteins in same PDB: d2j88a1, d2j88h1, d2j88l1
    automatically matched to d1a0ql2

Details for d2j88l2

PDB Entry: 2j88 (more details), 2.6 Å

PDB Description: Hyaluronidase in complex with a monoclonal IgG Fab fragment
PDB Compounds: (L:) fab

SCOP Domain Sequences for d2j88l2:

Sequence, based on SEQRES records: (download)

>d2j88l2 b.1.1.2 (L:109-205) Immunoglobulin light chain kappa constant domain, CL-kappa {Mouse (Mus musculus) [TaxId: 10090]}
adaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqds
kdstysmsstltltkdeyerhnsytceathktstspi

Sequence, based on observed residues (ATOM records): (download)

>d2j88l2 b.1.1.2 (L:109-205) Immunoglobulin light chain kappa constant domain, CL-kappa {Mouse (Mus musculus) [TaxId: 10090]}
adaaptvsifvvcflnnfypkdinvkwkgvlnswtdqddstysmsstltltkdeytceat
hktstspi

SCOP Domain Coordinates for d2j88l2:

Click to download the PDB-style file with coordinates for d2j88l2.
(The format of our PDB-style files is described here.)

Timeline for d2j88l2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2j88l1