SCOP 1.73: Domain d2j88l1: 2j88 L:2-108

Lineage for d2j88l1 (2j88 L:2-108)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (29 proteins)

6. Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (14 species)
   VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 4 [TaxId:10090] [88531] (181 PDB entries)

8. Domain d2j88l1: 2j88 L:2-108 [138137]
   Other proteins in same PDB: d2j88a1, d2j88h1, d2j88l2
   automatically matched to d1a0ql1

Details for d2j88l1

PDB Entry: 2j88, 2.6 Å

PDB Description: Hyaluronidase in complex with a monoclonal IgG Fab fragment

PDB Compounds: (L:) fab

SCOP Domain Sequences for d2j88l1:

Sequence; same for both SEQRES and ATOM records:

>d2j88l1 b.1.1.1 (L:2-108) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]}
iqmtqspaslsasvgetvtitcraseniysyltwyqqkqgkspqllvynaktlaegvpsr
fsgsgsgtqfslkisslqpedfgnyycqhhygtrtfgggtrleikr

Timeline for d2j88l1:

• d2j88l1 is new in SCOP 1.73
  
• d2j88l1 appears in SCOP 1.75
  
• d2j88l1 appears in the current release, SCOPe 2.08