Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) |
Family c.1.8.9: Bee venom hyaluronidase [69387] (2 proteins) distorted barrel lacks the second strand |
Protein automated matches [190334] (1 species) not a true protein |
Species Honeybee (Apis mellifera) [TaxId:7460] [187156] (1 PDB entry) |
Domain d2j88a_: 2j88 A: [138135] Other proteins in same PDB: d2j88h1, d2j88l1, d2j88l2 automated match to d1fcua_ |
PDB Entry: 2j88 (more details), 2.6 Å
SCOPe Domain Sequences for d2j88a_:
Sequence, based on SEQRES records: (download)
>d2j88a_ c.1.8.9 (A:) automated matches {Honeybee (Apis mellifera) [TaxId: 7460]} efnvywnvptfmchkyglrfeevsekygilqnwmdkfrgeeiailydpgmfpallkdpng nvvarnggvpqlgnltkhlqvfrdhlinqipdksfpgvgvidfeswrpifrqnwaslqpy kklsvevvrrehpfwddqrveqeakrrfekygqlfmeetlkaakrmrpaanwgyyaypyc ynltpnqpsaqceattmqendkmswlfesedvllpsvylrwnltsgervglvggrvkeal riarqmttsrkkvlpyywykyqdrrdtdlsradleatlrkitdlgadgfiiwgssddint kakclqfreylnnelgpavkrial
>d2j88a_ c.1.8.9 (A:) automated matches {Honeybee (Apis mellifera) [TaxId: 7460]} efnvywnvptfmchkyglrfeevsekygilqnwmdkfrgeeiailydpgmfpallkvvar nggvpqlgnltkhlqvfrdhlinqipdksfpgvgvidfeswrpifrqnwaslqpykklsv evvrrehpfwddqrveqeakrrfekygqlfmeetlkaakrmrpaanwgyyaypycynltp nqpsaqceattmqendkmswlfesedvllpsvylrwnltsgervglvggrvkealriarq mttsrkkvlpyywykyqdrrdtdlsradleatlrkitdlgadgfiiwgssddintkakcl qfreylnnelgpavkrial
Timeline for d2j88a_: