SCOP 1.75: Domain d2j6ua1: 2j6u A:244-344

Lineage for d2j6ua1 (2j6u A:244-344)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.240: Lesion bypass DNA polymerase (Y-family), little finger domain [100878] (1 superfamily)
   beta-alpha-beta(2)-alpha-beta; antiparallel beta-sheet: order 1423; "reversed" ferredoxin-like topology

4. Superfamily d.240.1: Lesion bypass DNA polymerase (Y-family), little finger domain [100879] (1 family)

5. Family d.240.1.1: Lesion bypass DNA polymerase (Y-family), little finger domain [100880] (5 proteins)

6. Protein DinB homolog (DBH) [100881] (3 species)

7. Species Archaeon Sulfolobus solfataricus, DNA polymerase IV [TaxId:2287] [100882] (50 PDB entries)

8. Domain d2j6ua1: 2j6u A:244-344 [138093]
   Other proteins in same PDB: d2j6ua2
   automatically matched to d1n48a1
   complexed with 6og, ca, dgt

Details for d2j6ua1

PDB Entry: 2j6u, 2.5 Å

PDB Description: ternary complex of sulfolobus solfataricus dpo4 dna polymerase, o6-methylguanine modified dna, and dgtp.

PDB Compounds: (A:) DNA polymerase IV

SCOP Domain Sequences for d2j6ua1:

Sequence; same for both SEQRES and ATOM records:

>d2j6ua1 d.240.1.1 (A:244-344) DinB homolog (DBH) {Archaeon Sulfolobus solfataricus, DNA polymerase IV [TaxId: 2287]}
vrksigrivtmkrnsrnleeikpylfraieesyykldkripkaihvvavtedldivsrgr
tfphgisketaysesvkllqkileederkirrigvrfskfi

Timeline for d2j6ua1:

• d2j6ua1 first appeared in SCOP 1.73
  
• d2j6ua1 appears in SCOPe 2.01
  
• d2j6ua1 appears in the current release, SCOPe 2.08