SCOPe 2.06: Domain d2j6ea2: 2j6e A:340-445

Lineage for d2j6ea2 (2j6e A:340-445)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (16 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (698 PDB entries)

8. Domain d2j6ea2: 2j6e A:340-445 [138081]
   Other proteins in same PDB: d2j6eh1, d2j6eh2, d2j6ei1, d2j6ei2, d2j6el1, d2j6el2, d2j6em1
   automated match to d1hzhh4
   complexed with act, cac, cd, mpd, zn

Details for d2j6ea2

PDB Entry: 2j6e, 3 Å

PDB Description: crystal structure of an autoimmune complex between a human igm rheumatoid factor and igg1 fc reveals a novel fc epitope and evidence for affinity maturation

PDB Compounds: (A:) Ig gamma-1 chain C region

SCOPe Domain Sequences for d2j6ea2:

Sequence; same for both SEQRES and ATOM records:

>d2j6ea2 b.1.1.2 (A:340-445) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kgqprepqvytlppsrdeltknqvsltclvkgfypsdiavewesngqpennykttppvld
sdgsfflyskltvdksrwqqgnvfscsvmhealhnhytqkslslsp

Timeline for d2j6ea2:

• d2j6ea2 first appeared in SCOP 1.73
  
• d2j6ea2 appears in SCOPe 2.05
  
• d2j6ea2 appears in SCOPe 2.07
  
• d2j6ea2 appears in the current release, SCOPe 2.08