SCOP 1.73: Domain d2j5xb1: 2j5x B:11-174

Lineage for d2j5xb1 (2j5x B:11-174)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (24 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (78 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein ADP-ribosylation factor [52614] (14 species)

7. Species Human (Homo sapiens), ARF6 [TaxId:9606] [52617] (5 PDB entries)

8. Domain d2j5xb1: 2j5x B:11-174 [138073]
   automatically matched to d1e0sa_
   complexed with gsp, mg

Details for d2j5xb1

PDB Entry: 2j5x, 2.8 Å

PDB Description: structure of the small g protein arf6 in complex with gtpgammas

PDB Compounds: (B:) ADP-ribosylation factor 6

SCOP Domain Sequences for d2j5xb1:

Sequence; same for both SEQRES and ATOM records:

>d2j5xb1 c.37.1.8 (B:11-174) ADP-ribosylation factor {Human (Homo sapiens), ARF6 [TaxId: 9606]}
nkemrilmlgldaagkttilyklklgqsvttiptvgfnvetvtyknvkfnvwdvggqdki
rplwrhyytgtqglifvvdcadrdridearqelhriindremrdaiilifankqdlpdam
kpheiqeklgltrirdrnwyvqpscatsgdglyegltwltsnyk

Timeline for d2j5xb1:

• d2j5xb1 is new in SCOP 1.73
  
• d2j5xb1 appears in SCOP 1.75
  
• d2j5xb1 appears in the current release, SCOPe 2.08, called d2j5xb_