SCOPe 2.06: Domain d2j5xa_: 2j5x A:

Lineage for d2j5xa_ (2j5x A:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (79 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein ADP-ribosylation factor [52614] (16 species)

7. Species Human (Homo sapiens), ARF6 [TaxId:9606] [52617] (5 PDB entries)

8. Domain d2j5xa_: 2j5x A: [138072]
   automated match to d1e0sa_
   complexed with gsp, mg

Details for d2j5xa_

PDB Entry: 2j5x, 2.8 Å

PDB Description: structure of the small g protein arf6 in complex with gtpgammas

PDB Compounds: (A:) ADP-ribosylation factor 6

SCOPe Domain Sequences for d2j5xa_:

Sequence; same for both SEQRES and ATOM records:

>d2j5xa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF6 [TaxId: 9606]}
nkemrilmlgldaagkttilyklklgqsvttiptvgfnvetvtyknvkfnvwdvggqdki
rplwrhyytgtqglifvvdcadrdridearqelhriindremrdaiilifankqdlpdam
kpheiqeklgltrirdrnwyvqpscatsgdglyegltwltsnyk

Timeline for d2j5xa_:

• d2j5xa_ first appeared in SCOP 1.73, called d2j5xa1
  
• d2j5xa_ appears in SCOPe 2.05
  
• d2j5xa_ appears in SCOPe 2.07
  
• d2j5xa_ appears in the current release, SCOPe 2.08