Lineage for d2j5rb2 (2j5r B:163-330)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2232528Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
    unusual fold, defines family
  4. 2232529Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families) (S)
  5. 2232530Family d.162.1.1: Lactate & malate dehydrogenases, C-terminal domain [56328] (5 proteins)
    N-terminal domain is NAD-binding module (alpha/beta Rossmann-fold domain)
    automatically mapped to Pfam PF02866
  6. 2232895Protein automated matches [226882] (7 species)
    not a true protein
  7. 2232905Species Haloarcula marismortui [TaxId:2238] [225148] (4 PDB entries)
  8. 2232919Domain d2j5rb2: 2j5r B:163-330 [138062]
    Other proteins in same PDB: d2j5ra1, d2j5rb1, d2j5rc1, d2j5rd1
    automated match to d1d3aa2
    complexed with cl

Details for d2j5rb2

PDB Entry: 2j5r (more details), 2.25 Å

PDB Description: 2.25 a resolution structure of the wild type malate dehydrogenase from haloarcula marismortui after second radiation burn (radiation damage series)
PDB Compounds: (B:) malate dehydrogenase

SCOPe Domain Sequences for d2j5rb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2j5rb2 d.162.1.1 (B:163-330) automated matches {Haloarcula marismortui [TaxId: 2238]}
fggrldsarfryvlseefdapvqnvegtilgehgdaqvpvfskvrvdgtdpefsgdekeq
llgdlqesamdvierkgatewgpargvahmveailhdtgevlpasvklegefghedtafg
vpvrlgsngveeivewdlddyeqdlmadaaeklsdqydkis

SCOPe Domain Coordinates for d2j5rb2:

Click to download the PDB-style file with coordinates for d2j5rb2.
(The format of our PDB-style files is described here.)

Timeline for d2j5rb2: