Lineage for d2j5rb2 (2j5r B:164-330)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 737029Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
    unusual fold, defines family
  4. 737030Superfamily d.162.1: LDH C-terminal domain-like [56327] (2 families) (S)
  5. 737031Family d.162.1.1: Lactate & malate dehydrogenases, C-terminal domain [56328] (4 proteins)
    N-terminal domain is NAD-binding module (alpha/beta Rossmann-fold domain)
  6. 737139Protein Malate dehydrogenase [56329] (11 species)
  7. 737144Species Archaeon Haloarcula marismortui [TaxId:2238] [56335] (8 PDB entries)
  8. 737154Domain d2j5rb2: 2j5r B:164-330 [138062]
    Other proteins in same PDB: d2j5ra1, d2j5rb1, d2j5rc1, d2j5rd1
    automatically matched to d1d3aa2
    complexed with cl

Details for d2j5rb2

PDB Entry: 2j5r (more details), 2.25 Å

PDB Description: 2.25 a resolution structure of the wild type malate dehydrogenase from haloarcula marismortui after second radiation burn (radiation damage series)
PDB Compounds: (B:) malate dehydrogenase

SCOP Domain Sequences for d2j5rb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2j5rb2 d.162.1.1 (B:164-330) Malate dehydrogenase {Archaeon Haloarcula marismortui [TaxId: 2238]}
ggrldsarfryvlseefdapvqnvegtilgehgdaqvpvfskvrvdgtdpefsgdekeql
lgdlqesamdvierkgatewgpargvahmveailhdtgevlpasvklegefghedtafgv
pvrlgsngveeivewdlddyeqdlmadaaeklsdqydkis

SCOP Domain Coordinates for d2j5rb2:

Click to download the PDB-style file with coordinates for d2j5rb2.
(The format of our PDB-style files is described here.)

Timeline for d2j5rb2: