SCOPe 2.02: Domain d2j5qc2: 2j5q C:164-330

Lineage for d2j5qc2 (2j5q C:164-330)

1. Root: SCOPe 2.02

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
   unusual fold, defines family

4. Superfamily d.162.1: LDH C-terminal domain-like [56327] (2 families)

5. Family d.162.1.1: Lactate & malate dehydrogenases, C-terminal domain [56328] (4 proteins)
   N-terminal domain is NAD-binding module (alpha/beta Rossmann-fold domain)

6. Protein Malate dehydrogenase [56329] (11 species)

7. Species Haloarcula marismortui [TaxId:2238] [56335] (8 PDB entries)

8. Domain d2j5qc2: 2j5q C:164-330 [138056]
   Other proteins in same PDB: d2j5qa1, d2j5qb1, d2j5qc1, d2j5qd1
   automatically matched to d1d3aa2
   complexed with cl

Details for d2j5qc2

PDB Entry: 2j5q, 2.15 Å

PDB Description: 2.15 a resolution structure of the wild type malate dehydrogenase from haloarcula marismortui after first radiation burn (radiation damage series)

PDB Compounds: (C:) malate dehydrogenase

SCOPe Domain Sequences for d2j5qc2:

Sequence; same for both SEQRES and ATOM records:

>d2j5qc2 d.162.1.1 (C:164-330) Malate dehydrogenase {Haloarcula marismortui [TaxId: 2238]}
ggrldsarfryvlseefdapvqnvegtilgehgdaqvpvfskvrvdgtdpefsgdekeql
lgdlqesamdvierkgatewgpargvahmveailhdtgevlpasvklegefghedtafgv
pvrlgsngveeivewdlddyeqdlmadaaeklsdqydkis

Timeline for d2j5qc2:

• d2j5qc2 first appeared in SCOP 1.73
  
• d2j5qc2 appears in SCOPe 2.01
  
• d2j5qc2 appears in SCOPe 2.03
  
• d2j5qc2 appears in the current release, SCOPe 2.08