Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily) unusual fold, defines family |
Superfamily d.162.1: LDH C-terminal domain-like [56327] (2 families) |
Family d.162.1.1: Lactate & malate dehydrogenases, C-terminal domain [56328] (4 proteins) N-terminal domain is NAD-binding module (alpha/beta Rossmann-fold domain) |
Protein Malate dehydrogenase [56329] (11 species) |
Species Haloarcula marismortui [TaxId:2238] [56335] (8 PDB entries) |
Domain d2j5qc2: 2j5q C:164-330 [138056] Other proteins in same PDB: d2j5qa1, d2j5qb1, d2j5qc1, d2j5qd1 automatically matched to d1d3aa2 complexed with cl |
PDB Entry: 2j5q (more details), 2.15 Å
SCOPe Domain Sequences for d2j5qc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2j5qc2 d.162.1.1 (C:164-330) Malate dehydrogenase {Haloarcula marismortui [TaxId: 2238]} ggrldsarfryvlseefdapvqnvegtilgehgdaqvpvfskvrvdgtdpefsgdekeql lgdlqesamdvierkgatewgpargvahmveailhdtgevlpasvklegefghedtafgv pvrlgsngveeivewdlddyeqdlmadaaeklsdqydkis
Timeline for d2j5qc2: