Lineage for d2j59c_ (2j59 C:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1593542Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 1593543Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 1594390Family c.37.1.8: G proteins [52592] (79 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 1594391Protein ADP-ribosylation factor [52614] (16 species)
  7. 1594401Species Human (Homo sapiens), ARF1 [TaxId:9606] [52615] (12 PDB entries)
    Uniprot P32889
  8. 1594414Domain d2j59c_: 2j59 C: [138031]
    Other proteins in same PDB: d2j59m1, d2j59n_, d2j59o_, d2j59p_, d2j59q_, d2j59r_
    automated match to d1o3ya_
    complexed with dio, edo, gtp, mg, so4

Details for d2j59c_

PDB Entry: 2j59 (more details), 2.1 Å

PDB Description: crystal structure of the arf1:arhgap21-arfbd complex
PDB Compounds: (C:) ADP-ribosylation factor 1

SCOPe Domain Sequences for d2j59c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2j59c_ c.37.1.8 (C:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]}
gsmrilmvgldaagkttilyklklgeivttiptigfnvetveyknisftvwdvggldkir
plwrhyfqntqglifvvdsndrervneareelmrmlaedelrdavllvfankqdlpnamn
aaeitdklglhslrhrnwyiqatcatsgdglyegldwlsnqlrnq

SCOPe Domain Coordinates for d2j59c_:

Click to download the PDB-style file with coordinates for d2j59c_.
(The format of our PDB-style files is described here.)

Timeline for d2j59c_: