Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) division into families based on beta-sheet topologies |
Family c.37.1.8: G proteins [52592] (79 proteins) core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest |
Protein ADP-ribosylation factor [52614] (16 species) |
Species Human (Homo sapiens), ARF1 [TaxId:9606] [52615] (14 PDB entries) Uniprot P32889 |
Domain d2j59a2: 2j59 A:18-180 [138029] Other proteins in same PDB: d2j59a3, d2j59b3, d2j59c3, d2j59d3, d2j59e3, d2j59f3, d2j59m1, d2j59n_, d2j59o_, d2j59p_, d2j59q_, d2j59r_ automated match to d1o3ya_ complexed with dio, edo, gtp, mg, so4 |
PDB Entry: 2j59 (more details), 2.1 Å
SCOPe Domain Sequences for d2j59a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2j59a2 c.37.1.8 (A:18-180) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]} mrilmvgldaagkttilyklklgeivttiptigfnvetveyknisftvwdvggldkirpl wrhyfqntqglifvvdsndrervneareelmrmlaedelrdavllvfankqdlpnamnaa eitdklglhslrhrnwyiqatcatsgdglyegldwlsnqlrnq
Timeline for d2j59a2: