SCOPe 2.06: Domain d2j55j_: 2j55 J:

Lineage for d2j55j_ (2j55 J:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.69: 7-bladed beta-propeller [50964] (15 superfamilies)
   consists of seven 4-stranded beta-sheet motifs; meander

4. Superfamily b.69.2: YVTN repeat-like/Quinoprotein amine dehydrogenase [50969] (4 families)

5. Family b.69.2.0: automated matches [232760] (1 protein)
   not a true family

6. Protein automated matches [232762] (1 species)
   not a true protein

7. Species Paracoccus denitrificans [TaxId:318586] [232763] (18 PDB entries)

8. Domain d2j55j_: 2j55 J: [138016]
   Other proteins in same PDB: d2j55a_, d2j55b_, d2j55l1, d2j55m_
   automated match to d3l4od_
   complexed with cu, gol

Details for d2j55j_

PDB Entry: 2j55, 2.15 Å

PDB Description: x-ray reduced paraccocus denitrificans methylamine dehydrogenase o-quinone in complex with amicyanin.

PDB Compounds: (J:) Methylamine dehydrogenase heavy chain

SCOPe Domain Sequences for d2j55j_:

Sequence; same for both SEQRES and ATOM records:

>d2j55j_ b.69.2.0 (J:) automated matches {Paracoccus denitrificans [TaxId: 318586]}
aetqaqetqgqaaaraaaadlaagqddeprileapapdarrvyvndpahfaavtqqfvid
geagrvigmidggflpnpvvaddgsfiahastvfsriargertdyvevfdpvtllptadi
elpdaprflvgtypwmtsltpdgktllfyqfspapavgvvdlegkafkrmldvpdcyhif
ptapdtffmhcrdgslakvafgtegtpeithtevfhpedeflinhpaysqkagrlvwpty
tgkihqidlssgdakflpavealteaeradgwrpggwqqvayhraldriyllvdqrdewr
hktasrfvvvldaktgerlakfemgheidsinvsqdekpllyalstgdktlyihdaesge
elrsvnqlghgpqvittadmg

Timeline for d2j55j_:

• d2j55j_ first appeared in SCOP 1.73, called d2j55j1
  
• d2j55j_ appears in SCOPe 2.05
  
• d2j55j_ appears in SCOPe 2.07
  
• d2j55j_ appears in the current release, SCOPe 2.08