Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) consists of two alpha+beta domains, C-terminal domain is mostly alpha helical |
Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) shares functional and structural similarities with the ATP-grasp fold and PIPK |
Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins) members organized in the groups and subfamiles specified by the comments |
Protein Aurora-related kinase 1 (aurora-2) [90038] (1 species) OPK group; AIRK subfamily; serine/threonine kinase |
Species Human (Homo sapiens) [TaxId:9606] [90039] (9 PDB entries) |
Domain d2j4zb1: 2j4z B:126-388 [138010] automatically matched to d1ol5a_ complexed with 626, ars |
PDB Entry: 2j4z (more details), 2 Å
SCOPe Domain Sequences for d2j4zb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2j4zb1 d.144.1.7 (B:126-388) Aurora-related kinase 1 (aurora-2) {Human (Homo sapiens) [TaxId: 9606]} rqwaledfeigrplgkgkfgnvylarekqskfilalkvlfkaqlekagvehqlrreveiq shlrhpnilrlygyfhdatrvylileyaplgtvyrelqklskfdeqrtatyitelanals ychskrvihrdikpenlllgsagelkiadfgwsvhapssrrttlcgtldylppemiegrm hdekvdlwslgvlcyeflvgkppfeantyqetykrisrveftfpdfvtegardlisrllk hnpsqrpmlrevlehpwitanss
Timeline for d2j4zb1: