SCOPe 2.07: Domain d2j4wl2: 2j4w L:108-214

Lineage for d2j4wl2 (2j4w L:108-214)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (17 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [224855] (654 PDB entries)

8. Domain d2j4wl2: 2j4w L:108-214 [138008]
   Other proteins in same PDB: d2j4wd1, d2j4wh1, d2j4wh2, d2j4wl1
   automated match to d3mbxl2

Details for d2j4wl2

PDB Entry: 2j4w, 2.5 Å

PDB Description: structure of a plasmodium vivax apical membrane antigen 1-fab f8.12.19 complex

PDB Compounds: (L:) fab fragment of monoclonal antibody f8.12.19

SCOPe Domain Sequences for d2j4wl2:

Sequence; same for both SEQRES and ATOM records:

>d2j4wl2 b.1.1.2 (L:108-214) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrnec

Timeline for d2j4wl2:

• d2j4wl2 first appeared in SCOP 1.73
  
• d2j4wl2 appears in SCOPe 2.06
  
• d2j4wl2 appears in the current release, SCOPe 2.08