Lineage for d2j4sb1 (2j4s B:1-455)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 774742Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 774743Superfamily a.104.1: Cytochrome P450 [48264] (1 family) (S)
  5. 774744Family a.104.1.1: Cytochrome P450 [48265] (22 proteins)
  6. 774808Protein Cytochrome P450 bm-3 [48268] (1 species)
  7. 774809Species Bacillus megaterium [TaxId:1404] [48269] (19 PDB entries)
    Uniprot P14779
  8. 774835Domain d2j4sb1: 2j4s B:1-455 [138006]
    automatically matched to d1jpza_
    complexed with hem, peg, zn

Details for d2j4sb1

PDB Entry: 2j4s (more details), 2.1 Å

PDB Description: p450 bm3 heme domain in complex with dmso
PDB Compounds: (B:) bifunctional p-450:nadph-p450 reductase

SCOP Domain Sequences for d2j4sb1:

Sequence, based on SEQRES records: (download)

>d2j4sb1 a.104.1.1 (B:1-455) Cytochrome P450 bm-3 {Bacillus megaterium [TaxId: 1404]}
tikempqpktfgelknlpllntdkpvqalmkiadelgeifkfeapgrvtrylssqrlike
acdesrfdknlsqalkfvrdfagdglftswtheknwkkahnillpsfsqqamkgyhammv
diavqlvqkwerlnadehievpedmtrltldtiglcgfnyrfnsfyrdqphpfitsmvra
ldeamnklqranpddpaydenkrqfqedikvmndlvdkiiadrkasgeqsddllthmlng
kdpetgeplddeniryqiitfliaghettsgllsfalyflvknphvlqkaaeeaarvlvd
pvpsykqvkqlkyvgmvlnealrlwptapafslyakedtvlggeyplekgdelmvlipql
hrdktiwgddveefrperfenpsaipqhafkpfgngqracigqqfalheatlvlgmmlkh
fdfedhtnyeldiketltlkpegfvvkakskkipl

Sequence, based on observed residues (ATOM records): (download)

>d2j4sb1 a.104.1.1 (B:1-455) Cytochrome P450 bm-3 {Bacillus megaterium [TaxId: 1404]}
tikempqpktfgelknlpllntdkpvqalmkiadelgeifkfeapgrvtrylssqrlike
acdesrfdknlsqalkfvrdfagdglftswtheknwkkahnillpsfsqqamkgyhammv
diavqlvqkwerlnadehievpedmtrltldtiglcgfnyrfnsfyrdqphpfitsmvra
ldeamnklqranpddpaydenkrqfqedikvmndlvdkiiadrkasgeqsddllthmlng
kdplddeniryqiitfliaghettsgllsfalyflvknphvlqkaaeeaarvlvdpvpsy
kqvkqlkyvgmvlnealrlwptapafslyakedtvlggeyplekgdelmvlipqlhrdkt
iwgddveefrperfenpsaipqhafkpfgngqracigqqfalheatlvlgmmlkhfdfed
htnyeldiketltlkpegfvvkakskkipl

SCOP Domain Coordinates for d2j4sb1:

Click to download the PDB-style file with coordinates for d2j4sb1.
(The format of our PDB-style files is described here.)

Timeline for d2j4sb1: