Lineage for d2j47a1 (2j47 A:437-589)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2351179Fold a.246: Hyaluronidase domain-like [140656] (3 superfamilies)
    5 helices; bundle, closed, left-handed twist; up-and-down (meander) topology
  4. 2351180Superfamily a.246.1: Hyaluronidase post-catalytic domain-like [140657] (2 families) (S)
  5. 2351181Family a.246.1.1: Hyaluronidase post-catalytic domain-like [140658] (2 proteins)
  6. 2351182Protein Glucosaminidase GH84 post-catalytic domain [140661] (1 species)
  7. 2351183Species Bacteroides thetaiotaomicron [TaxId:818] [140662] (8 PDB entries)
    Uniprot Q89ZI2 458-610! Uniprot Q89ZI2 458-611
  8. 2351188Domain d2j47a1: 2j47 A:437-589 [137991]
    Other proteins in same PDB: d2j47a2, d2j47a3
    complexed with gdv, gol

Details for d2j47a1

PDB Entry: 2j47 (more details), 1.98 Å

PDB Description: bacteroides thetaiotaomicron gh84 o-glcnacase in complex with a imidazole-pugnac hybrid inhibitor
PDB Compounds: (A:) glucosaminidase

SCOPe Domain Sequences for d2j47a1:

Sequence, based on SEQRES records: (download)

>d2j47a1 a.246.1.1 (A:437-589) Glucosaminidase GH84 post-catalytic domain {Bacteroides thetaiotaomicron [TaxId: 818]}
reesmdiqpaaerflkafkegknydkadfetlqytfermkesadillmntenkpliveit
pwvhqfkltaemgeevlkmvegrnesyflrkynhvkalqqqmfyidqtsnqnpyqpgvkt
atrvikplidrtfatvvkffnqkfnahldattd

Sequence, based on observed residues (ATOM records): (download)

>d2j47a1 a.246.1.1 (A:437-589) Glucosaminidase GH84 post-catalytic domain {Bacteroides thetaiotaomicron [TaxId: 818]}
reesmdiqpaaerflkafkydkadfetlqytfermkesadillmntenkpliveitpwvh
qfkltaemgeevlkmvegrnesyflrkynhvkalqqqmfyidqtsnqnpyqpgvktatrv
ikplidrtfatvvkffnqkfnahldattd

SCOPe Domain Coordinates for d2j47a1:

Click to download the PDB-style file with coordinates for d2j47a1.
(The format of our PDB-style files is described here.)

Timeline for d2j47a1: