Lineage for d2j1ma1 (2j1m A:2-455)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 646332Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 646333Superfamily a.104.1: Cytochrome P450 [48264] (1 family) (S)
  5. 646334Family a.104.1.1: Cytochrome P450 [48265] (21 proteins)
  6. 646395Protein Cytochrome P450 bm-3 [48268] (1 species)
  7. 646396Species Bacillus megaterium [TaxId:1404] [48269] (18 PDB entries)
  8. 646405Domain d2j1ma1: 2j1m A:2-455 [137953]
    automatically matched to d1jpza_
    complexed with dms, hem, zn

Details for d2j1ma1

PDB Entry: 2j1m (more details), 1.7 Å

PDB Description: p450 bm3 heme domain in complex with dmso
PDB Compounds: (A:) Cytochrome P450 102

SCOP Domain Sequences for d2j1ma1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2j1ma1 a.104.1.1 (A:2-455) Cytochrome P450 bm-3 {Bacillus megaterium [TaxId: 1404]}
ikempqpktfgelknlpllntdkpvqalmkiadelgeifkfeapgrvtrylssqrlikea
cdesrfdknlsqalkfvrdfagdglftswtheknwkkahnillpsfsqqamkgyhammvd
iavqlvqkwerlnadehievpedmtrltldtiglcgfnyrfnsfyrdqphpfitsmvral
deamnklqranpddpaydenkrqfqedikvmndlvdkiiadrkasgeqsddllthmlngk
dpetgeplddeniryqiitfliaghettsgllsfalyflvknphvlqkaaeeaarvlvdp
vpsykqvkqlkyvgmvlnealrlwptapafslyakedtvlggeyplekgdelmvlipqlh
rdktiwgddveefrperfenpsaipqhafkpfgngqracigqqfalheatlvlgmmlkhf
dfedhtnyeldiketltlkpegfvvkakskkipl

SCOP Domain Coordinates for d2j1ma1:

Click to download the PDB-style file with coordinates for d2j1ma1.
(The format of our PDB-style files is described here.)

Timeline for d2j1ma1: