Lineage for d2j1ky_ (2j1k Y:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1755447Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1755448Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 1757949Protein automated matches [190119] (18 species)
    not a true protein
  7. 1758005Species Human (Homo sapiens) [TaxId:9606] [188740] (120 PDB entries)
  8. 1758093Domain d2j1ky_: 2j1k Y: [137951]
    Other proteins in same PDB: d2j1kc1, d2j1kd_, d2j1ke_, d2j1kf_, d2j1kh_, d2j1ki_, d2j1kl_, d2j1km_, d2j1kn_, d2j1kq_, d2j1kr_, d2j1ks_
    automated match to d1eaja_

Details for d2j1ky_

PDB Entry: 2j1k (more details), 2.3 Å

PDB Description: cav-2 fibre head in complex with car d1
PDB Compounds: (Y:) coxsackievirus and adenovirus receptor

SCOPe Domain Sequences for d2j1ky_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2j1ky_ b.1.1.1 (Y:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
slsittpeemiekakgetaylpckftlspedqgpldiewlispadnqkvdqviilysgdk
iyddyypdlkgrvhftsndlksgdasinvtnlqlsdigtyqckvkkapgvankkihlvv

SCOPe Domain Coordinates for d2j1ky_:

Click to download the PDB-style file with coordinates for d2j1ky_.
(The format of our PDB-style files is described here.)

Timeline for d2j1ky_: