SCOP 1.75: Domain d2j1kx1: 2j1k X:21-138

Lineage for d2j1kx1 (2j1k X:21-138)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (32 proteins)

6. Protein Coxsackie virus and adenovirus receptor (Car), domain 1 [48730] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [48731] (8 PDB entries)

8. Domain d2j1kx1: 2j1k X:21-138 [137950]
   Other proteins in same PDB: d2j1kc1, d2j1kd1, d2j1ke1, d2j1kf1, d2j1kh1, d2j1ki1, d2j1kl1, d2j1km1, d2j1kn1, d2j1kq1, d2j1kr1, d2j1ks1
   automatically matched to d1rsfa_

Details for d2j1kx1

PDB Entry: 2j1k, 2.3 Å

PDB Description: cav-2 fibre head in complex with car d1

PDB Compounds: (X:) coxsackievirus and adenovirus receptor

SCOP Domain Sequences for d2j1kx1:

Sequence; same for both SEQRES and ATOM records:

>d2j1kx1 b.1.1.1 (X:21-138) Coxsackie virus and adenovirus receptor (Car), domain 1 {Human (Homo sapiens) [TaxId: 9606]}
sittpeemiekakgetaylpckftlspedqgpldiewlispadnqkvdqviilysgdkiy
ddyypdlkgrvhftsndlksgdasinvtnlqlsdigtyqckvkkapgvankkihlvvl

Timeline for d2j1kx1:

• d2j1kx1 first appeared in SCOP 1.73
  
• d2j1kx1 is called d2j1kx_ in SCOPe 2.01
  
• d2j1kx1 appears in the current release, SCOPe 2.08, called d2j1kx_