Class b: All beta proteins [48724] (174 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (32 proteins) |
Protein Coxsackie virus and adenovirus receptor (Car), domain 1 [48730] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [48731] (8 PDB entries) |
Domain d2j1kx1: 2j1k X:21-138 [137950] Other proteins in same PDB: d2j1kc1, d2j1kd1, d2j1ke1, d2j1kf1, d2j1kh1, d2j1ki1, d2j1kl1, d2j1km1, d2j1kn1, d2j1kq1, d2j1kr1, d2j1ks1 automatically matched to d1rsfa_ |
PDB Entry: 2j1k (more details), 2.3 Å
SCOP Domain Sequences for d2j1kx1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2j1kx1 b.1.1.1 (X:21-138) Coxsackie virus and adenovirus receptor (Car), domain 1 {Human (Homo sapiens) [TaxId: 9606]} sittpeemiekakgetaylpckftlspedqgpldiewlispadnqkvdqviilysgdkiy ddyypdlkgrvhftsndlksgdasinvtnlqlsdigtyqckvkkapgvankkihlvvl
Timeline for d2j1kx1: