Lineage for d2j1ko1 (2j1k O:21-138)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 651988Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 651989Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (29 proteins)
  6. 652130Protein Coxsackie virus and adenovirus receptor (Car), domain 1 [48730] (1 species)
  7. 652131Species Human (Homo sapiens) [TaxId:9606] [48731] (8 PDB entries)
  8. 652142Domain d2j1ko1: 2j1k O:21-138 [137946]
    automatically matched to d1rsfa_

Details for d2j1ko1

PDB Entry: 2j1k (more details), 2.3 Å

PDB Description: cav-2 fibre head in complex with car d1
PDB Compounds: (O:) coxsackievirus and adenovirus receptor

SCOP Domain Sequences for d2j1ko1:

Sequence, based on SEQRES records: (download)

>d2j1ko1 b.1.1.1 (O:21-138) Coxsackie virus and adenovirus receptor (Car), domain 1 {Human (Homo sapiens) [TaxId: 9606]}
sittpeemiekakgetaylpckftlspedqgpldiewlispadnqkvdqviilysgdkiy
ddyypdlkgrvhftsndlksgdasinvtnlqlsdigtyqckvkkapgvankkihlvvl

Sequence, based on observed residues (ATOM records): (download)

>d2j1ko1 b.1.1.1 (O:21-138) Coxsackie virus and adenovirus receptor (Car), domain 1 {Human (Homo sapiens) [TaxId: 9606]}
sittpeemiekakgetaylpckftlspedqgpldiewlispadvdqviilysgdkiyddy
ypdlkgrvhftsndlksgdasinvtnlqlsdigtyqckvkkapgvankkihlvvl

SCOP Domain Coordinates for d2j1ko1:

Click to download the PDB-style file with coordinates for d2j1ko1.
(The format of our PDB-style files is described here.)

Timeline for d2j1ko1: