SCOP 1.75: Domain d2j12a1: 2j12 A:184-365

Lineage for d2j12a1 (2j12 A:184-365)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.21: Virus attachment protein globular domain [49834] (1 superfamily)
   sandwich, 10 strands in 2 sheets; greek-key

4. Superfamily b.21.1: Virus attachment protein globular domain [49835] (3 families)

5. Family b.21.1.1: Adenovirus fiber protein "knob" domain [49836] (1 protein)

6. Protein Adenovirus fiber protein "knob" domain [49837] (7 species)

7. Species Human adenovirus type 37 [TaxId:52275] [110136] (4 PDB entries)
   Uniprot Q64823 182-365
   Uniprot Q64823 181-365
   Uniprot Q64823 182-365 ! Uniprot Q64823 181-365

8. Domain d2j12a1: 2j12 A:184-365 [137932]
   Other proteins in same PDB: d2j12b1
   automatically matched to d1uxaa_
   complexed with ca

Details for d2j12a1

PDB Entry: 2j12, 1.5 Å

PDB Description: ad37 fibre head in complex with car d1

PDB Compounds: (A:) fiber protein

SCOP Domain Sequences for d2j12a1:

Sequence; same for both SEQRES and ATOM records:

>d2j12a1 b.21.1.1 (A:184-365) Adenovirus fiber protein "knob" domain {Human adenovirus type 37 [TaxId: 52275]}
rtlwttpdtspnctiaqdkdskltlvltkcgsqilanvslivvagkyhiinnktnpkiks
ftikllfnkngvlldnsnlgkaywnfrsgnsnvstayekaigfmpnlvaypkpsnskkya
rdivygtiylggkpdqpavikttfnqetgceysitfnfswsktyenvefettsftfsyia
qe

Timeline for d2j12a1:

• d2j12a1 first appeared in SCOP 1.73
  
• d2j12a1 is called d2j12a_ in SCOPe 2.01
  
• d2j12a1 appears in the current release, SCOPe 2.08, called d2j12a_