Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) division into families based on beta-sheet topologies |
Family c.37.1.19: Tandem AAA-ATPase domain [81268] (41 proteins) duplication: tandem repeat of two RecA-like (AAA) domains |
Protein automated matches [190301] (7 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187108] (5 PDB entries) |
Domain d2j0sa1: 2j0s A:21-243 [137913] Other proteins in same PDB: d2j0sc_, d2j0sd_ automated match to d2j0sa1 protein/DNA complex; protein/RNA complex; complexed with anp, mg |
PDB Entry: 2j0s (more details), 2.21 Å
SCOPe Domain Sequences for d2j0sa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2j0sa1 c.37.1.19 (A:21-243) automated matches {Human (Homo sapiens) [TaxId: 9606]} edmtkvefetseevdvtptfdtmglredllrgiyaygfekpsaiqqraikqiikgrdvia qsqsgtgktatfsisvlqcldiqvretqalilaptrelavqiqkgllalgdymnvqchac iggtnvgedirkldygqhvvagtpgrvfdmirrrslrtraikmlvldeademlnkgfkeq iydvyrylppatqvvlisatlpheilemtnkfmtdpirilvkr
Timeline for d2j0sa1: