Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.232: Mago nashi protein [89816] (1 superfamily) beta(4)-alpha-beta(2)-alpha; 2 layers: alpha/beta; antiparallel beta-sheet, order: 651234 |
Superfamily d.232.1: Mago nashi protein [89817] (1 family) automatically mapped to Pfam PF02792 |
Family d.232.1.1: Mago nashi protein [89818] (2 proteins) |
Protein Mago nashi protein [89819] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [102750] (5 PDB entries) |
Domain d2j0qc1: 2j0q C:4-145 [137908] Other proteins in same PDB: d2j0qa1, d2j0qa2, d2j0qb1, d2j0qb2, d2j0qd1, d2j0qg1 automatically matched to d1p27a_ protein/RNA complex; complexed with anp, mg |
PDB Entry: 2j0q (more details), 3.2 Å
SCOPe Domain Sequences for d2j0qc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2j0qc1 d.232.1.1 (C:4-145) Mago nashi protein {Human (Homo sapiens) [TaxId: 9606]} dfylryyvghkgkfgheflefefrpdgklryannsnykndvmirkeayvhksvmeelkri iddseitkeddalwpppdrvgrqeleivigdehisfttskigslidvnqskdpeglrvfy ylvqdlkclvfsliglhfkikp
Timeline for d2j0qc1: