Lineage for d2j0qc1 (2j0q C:4-145)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3008314Fold d.232: Mago nashi protein [89816] (1 superfamily)
    beta(4)-alpha-beta(2)-alpha; 2 layers: alpha/beta; antiparallel beta-sheet, order: 651234
  4. 3008315Superfamily d.232.1: Mago nashi protein [89817] (1 family) (S)
    automatically mapped to Pfam PF02792
  5. 3008316Family d.232.1.1: Mago nashi protein [89818] (2 proteins)
  6. 3008317Protein Mago nashi protein [89819] (2 species)
  7. 3008323Species Human (Homo sapiens) [TaxId:9606] [102750] (5 PDB entries)
  8. 3008331Domain d2j0qc1: 2j0q C:4-145 [137908]
    Other proteins in same PDB: d2j0qa1, d2j0qa2, d2j0qb1, d2j0qb2, d2j0qd1, d2j0qg1
    automatically matched to d1p27a_
    protein/RNA complex; complexed with anp, mg

Details for d2j0qc1

PDB Entry: 2j0q (more details), 3.2 Å

PDB Description: the crystal structure of the exon junction complex at 3.2 a resolution
PDB Compounds: (C:) Protein mago nashi homolog

SCOPe Domain Sequences for d2j0qc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2j0qc1 d.232.1.1 (C:4-145) Mago nashi protein {Human (Homo sapiens) [TaxId: 9606]}
dfylryyvghkgkfgheflefefrpdgklryannsnykndvmirkeayvhksvmeelkri
iddseitkeddalwpppdrvgrqeleivigdehisfttskigslidvnqskdpeglrvfy
ylvqdlkclvfsliglhfkikp

SCOPe Domain Coordinates for d2j0qc1:

Click to download the PDB-style file with coordinates for d2j0qc1.
(The format of our PDB-style files is described here.)

Timeline for d2j0qc1: