SCOPe 2.06: Domain d2j0qa1: 2j0q A:22-243

Lineage for d2j0qa1 (2j0q A:22-243)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.19: Tandem AAA-ATPase domain [81268] (24 proteins)
   duplication: tandem repeat of two RecA-like (AAA) domains

6. Protein Probable ATP-dependent RNA helicase DDX48 [142314] (1 species)
   Eukaryotic translation initiation factor 4A isoform 3

7. Species Human (Homo sapiens) [TaxId:9606] [142315] (2 PDB entries)
   Uniprot P38919 22-243! Uniprot P38919 244-411

8. Domain d2j0qa1: 2j0q A:22-243 [137904]
   Other proteins in same PDB: d2j0qc1, d2j0qd1, d2j0qf1, d2j0qg1
   automatically matched to 2HYI C:22-243
   protein/RNA complex; complexed with anp, mg

Details for d2j0qa1

PDB Entry: 2j0q, 3.2 Å

PDB Description: the crystal structure of the exon junction complex at 3.2 a resolution

PDB Compounds: (A:) ATP-dependent RNA helicase ddx48

SCOPe Domain Sequences for d2j0qa1:

Sequence; same for both SEQRES and ATOM records:

>d2j0qa1 c.37.1.19 (A:22-243) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]}
dmtkvefetseevdvtptfdtmglredllrgiyaygfekpsaiqqraikqiikgrdviaq
sqsgtgktatfsisvlqcldiqvretqalilaptrelavqiqkgllalgdymnvqchaci
ggtnvgedirkldygqhvvagtpgrvfdmirrrslrtraikmlvldeademlnkgfkeqi
ydvyrylppatqvvlisatlpheilemtnkfmtdpirilvkr

Timeline for d2j0qa1:

• d2j0qa1 first appeared in SCOP 1.73
  
• d2j0qa1 appears in SCOPe 2.05
  
• d2j0qa1 appears in SCOPe 2.07
  
• d2j0qa1 appears in the current release, SCOPe 2.08