Lineage for d2j02p1 (2j02 P:1-83)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2942074Fold d.27: Ribosomal protein S16 [54564] (1 superfamily)
    beta(4)-alpha-beta; 2 layers: alpha/beta; mixed beta-sheet, order: 51234
  4. 2942075Superfamily d.27.1: Ribosomal protein S16 [54565] (1 family) (S)
  5. 2942076Family d.27.1.1: Ribosomal protein S16 [54566] (1 protein)
  6. 2942077Protein Ribosomal protein S16 [54567] (3 species)
  7. 2942107Species Thermus thermophilus [TaxId:274] [54568] (37 PDB entries)
    Uniprot P80379
  8. 2942123Domain d2j02p1: 2j02 P:1-83 [137881]
    Other proteins in same PDB: d2j02b1, d2j02c1, d2j02c2, d2j02d1, d2j02e1, d2j02e2, d2j02f1, d2j02g1, d2j02h1, d2j02i1, d2j02j1, d2j02k1, d2j02l1, d2j02m1, d2j02n1, d2j02o1, d2j02q1, d2j02r1, d2j02s1, d2j02t1, d2j02u1
    protein/RNA complex; complexed with mg, par, zn
    protein/RNA complex; complexed with mg, par, zn

Details for d2j02p1

PDB Entry: 2j02 (more details), 2.8 Å

PDB Description: Structure of the Thermus thermophilus 70S ribosome complexed with mRNA, tRNA and paromomycin (part 3 of 4). This file contains the 30s subunit, mrna, a-, p- and e-site trnas and paromomycin for molecule II.
PDB Compounds: (P:) 30S ribosomal protein S16

SCOPe Domain Sequences for d2j02p1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2j02p1 d.27.1.1 (P:1-83) Ribosomal protein S16 {Thermus thermophilus [TaxId: 274]}
mvkirlarfgskhnphyrivvtdarrkrdgkyiekigyydprkttpdwlkvdverarywl
svgaqptdtarrllrqagvfrqe

SCOPe Domain Coordinates for d2j02p1:

Click to download the PDB-style file with coordinates for d2j02p1.
(The format of our PDB-style files is described here.)

Timeline for d2j02p1: