Lineage for d2j02n1 (2j02 N:2-61)

  1. Root: SCOPe 2.03
  2. 1458801Class g: Small proteins [56992] (90 folds)
  3. 1463401Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
    alpha+beta metal(zinc)-bound fold
  4. 1463402Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (19 families) (S)
  5. 1463710Family g.39.1.7: Ribosomal protein S14 [57752] (1 protein)
  6. 1463711Protein Ribosomal protein S14 [57753] (2 species)
  7. 1463737Species Thermus thermophilus [TaxId:274] [57754] (45 PDB entries)
    Uniprot P24320
  8. 1463753Domain d2j02n1: 2j02 N:2-61 [137879]
    Other proteins in same PDB: d2j02b1, d2j02c1, d2j02c2, d2j02d1, d2j02e1, d2j02e2, d2j02f1, d2j02g1, d2j02h1, d2j02i1, d2j02j1, d2j02k1, d2j02l1, d2j02m1, d2j02o1, d2j02p1, d2j02q1, d2j02r1, d2j02s1, d2j02t1, d2j02u1
    automatically matched to d1fjgn_
    protein/RNA complex; complexed with mg, par, zn

Details for d2j02n1

PDB Entry: 2j02 (more details), 2.8 Å

PDB Description: Structure of the Thermus thermophilus 70S ribosome complexed with mRNA, tRNA and paromomycin (part 3 of 4). This file contains the 30s subunit, mrna, a-, p- and e-site trnas and paromomycin for molecule II.
PDB Compounds: (N:) 30S ribosomal protein S14

SCOPe Domain Sequences for d2j02n1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2j02n1 g.39.1.7 (N:2-61) Ribosomal protein S14 {Thermus thermophilus [TaxId: 274]}
arkaliekakrtpkfkvraytrcvrcgrarsvyrffglcriclrelahkgqlpgvrkasw

SCOPe Domain Coordinates for d2j02n1:

Click to download the PDB-style file with coordinates for d2j02n1.
(The format of our PDB-style files is described here.)

Timeline for d2j02n1: