SCOP 1.73: Domain d2j02n1: 2j02 N:2-61

Lineage for d2j02n1 (2j02 N:2-61)

1. Root: SCOP 1.73

2. Class g: Small proteins [56992] (85 folds)

3. Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
   alpha+beta metal(zinc)-bound fold

4. Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (15 families)

5. Family g.39.1.7: Ribosomal protein S14 [57752] (1 protein)

6. Protein Ribosomal protein S14 [57753] (1 species)

7. Species Thermus thermophilus [TaxId:274] [57754] (36 PDB entries)

8. Domain d2j02n1: 2j02 N:2-61 [137879]
   Other proteins in same PDB: d2j02b1, d2j02c1, d2j02c2, d2j02d1, d2j02e1, d2j02e2, d2j02f1, d2j02g1, d2j02h1, d2j02i1, d2j02j1, d2j02k1, d2j02l1, d2j02m1, d2j02o1, d2j02p1, d2j02q1, d2j02r1, d2j02s1, d2j02t1
   automatically matched to d1fjgn_
   complexed with 5mu, mg, par, zn

Details for d2j02n1

PDB Entry: 2j02, 2.8 Å

PDB Description: Structure of the Thermus thermophilus 70S ribosome complexed with mRNA, tRNA and paromomycin (part 3 of 4). This file contains the 30s subunit, mrna, a-, p- and e-site trnas and paromomycin for molecule II.

PDB Compounds: (N:) 30S ribosomal protein S14

SCOP Domain Sequences for d2j02n1:

Sequence; same for both SEQRES and ATOM records:

>d2j02n1 g.39.1.7 (N:2-61) Ribosomal protein S14 {Thermus thermophilus [TaxId: 274]}
arkaliekakrtpkfkvraytrcvrcgrarsvyrffglcriclrelahkgqlpgvrkasw

Timeline for d2j02n1:

• d2j02n1 is new in SCOP 1.73
  
• d2j02n1 appears in SCOP 1.75
  
• d2j02n1 appears in the current release, SCOPe 2.08