![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
![]() | Superfamily c.55.4: Translational machinery components [53137] (3 families) ![]() |
![]() | Family c.55.4.1: Ribosomal protein L18 and S11 [53138] (2 proteins) |
![]() | Protein Ribosomal protein S11 [53141] (2 species) |
![]() | Species Thermus thermophilus [TaxId:274] [53142] (46 PDB entries) Uniprot P80376 |
![]() | Domain d2j02k1: 2j02 K:11-129 [137876] Other proteins in same PDB: d2j02b1, d2j02c1, d2j02c2, d2j02d1, d2j02e1, d2j02e2, d2j02f1, d2j02g1, d2j02h1, d2j02i1, d2j02j1, d2j02l1, d2j02m1, d2j02n1, d2j02o1, d2j02p1, d2j02q1, d2j02r1, d2j02s1, d2j02t1, d2j02u1 protein/RNA complex; complexed with mg, par, zn protein/RNA complex; complexed with mg, par, zn |
PDB Entry: 2j02 (more details), 2.8 Å
SCOPe Domain Sequences for d2j02k1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2j02k1 c.55.4.1 (K:11-129) Ribosomal protein S11 {Thermus thermophilus [TaxId: 274]} krqvasgrayihasynntivtitdpdgnpitwssggvigykgsrkgtpyaaqlaaldaak kamaygmqsvdvivrgtgagreqairalqasglqvksivddtpvphngcrpkkkfrkas
Timeline for d2j02k1: