Class a: All alpha proteins [46456] (289 folds) |
Fold a.75: Ribosomal protein S7 [47972] (1 superfamily) core: 5 helices; contains one more helix and a beta-hairpin outside the core |
Superfamily a.75.1: Ribosomal protein S7 [47973] (1 family) |
Family a.75.1.1: Ribosomal protein S7 [47974] (1 protein) |
Protein Ribosomal protein S7 [47975] (4 species) |
Species Thermus thermophilus [TaxId:274] [47977] (47 PDB entries) Uniprot P17291 |
Domain d2j02g1: 2j02 G:2-156 [137872] Other proteins in same PDB: d2j02b1, d2j02c1, d2j02c2, d2j02d1, d2j02e1, d2j02e2, d2j02f1, d2j02h1, d2j02i1, d2j02j1, d2j02k1, d2j02l1, d2j02m1, d2j02n1, d2j02o1, d2j02p1, d2j02q1, d2j02r1, d2j02s1, d2j02t1, d2j02u1 protein/RNA complex; complexed with mg, par, zn protein/RNA complex; complexed with mg, par, zn |
PDB Entry: 2j02 (more details), 2.8 Å
SCOPe Domain Sequences for d2j02g1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2j02g1 a.75.1.1 (G:2-156) Ribosomal protein S7 {Thermus thermophilus [TaxId: 274]} arrrraevrqlqpdlvygdvlvtafinkimrdgkknlaarifydackiiqektgqeplkv fkqavenvkprmevrsrrvgganyqvpmevsprrqqslalrwlvqaanqrperraavria helmdaaegkggavkkkedvermaeanrayahyrw
Timeline for d2j02g1: