SCOPe 2.07: Domain d2j02e1: 2j02 E:74-154

Lineage for d2j02e1 (2j02 E:74-154)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
   core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover

4. Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families)

5. Family d.14.1.1: Translational machinery components [54212] (5 proteins)

6. Protein Ribosomal protein S5, C-terminal domain [54215] (3 species)

7. Species Thermus thermophilus [TaxId:274] [54217] (36 PDB entries)
   Uniprot P27152 ! Uniprot P80373

8. Domain d2j02e1: 2j02 E:74-154 [137869]
   Other proteins in same PDB: d2j02b1, d2j02c1, d2j02c2, d2j02d1, d2j02e2, d2j02f1, d2j02g1, d2j02h1, d2j02i1, d2j02j1, d2j02k1, d2j02l1, d2j02m1, d2j02n1, d2j02o1, d2j02p1, d2j02q1, d2j02r1, d2j02s1, d2j02t1, d2j02u1
   protein/RNA complex; complexed with mg, par, zn
   protein/RNA complex; complexed with mg, par, zn

Details for d2j02e1

PDB Entry: 2j02, 2.8 Å

PDB Description: Structure of the Thermus thermophilus 70S ribosome complexed with mRNA, tRNA and paromomycin (part 3 of 4). This file contains the 30s subunit, mrna, a-, p- and e-site trnas and paromomycin for molecule II.

PDB Compounds: (E:) 30S ribosomal protein S5

SCOPe Domain Sequences for d2j02e1:

Sequence; same for both SEQRES and ATOM records:

>d2j02e1 d.14.1.1 (E:74-154) Ribosomal protein S5, C-terminal domain {Thermus thermophilus [TaxId: 274]}
gtipheievefgaskivlkpaapgtgviagavprailelagvtdiltkelgsrnpiniay
atmealrqlrtkadverlrkg

Timeline for d2j02e1:

• d2j02e1 first appeared in SCOP 1.73
  
• d2j02e1 appears in SCOPe 2.06
  
• d2j02e1 appears in the current release, SCOPe 2.08