| Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
| Fold d.66: Alpha-L RNA-binding motif [55173] (1 superfamily) alpha(2)-beta(2)-loop-beta; 2 layers: alpha/beta |
Superfamily d.66.1: Alpha-L RNA-binding motif [55174] (5 families) ![]() common motif in otherwise different folds |
| Family d.66.1.2: Ribosomal protein S4 (bacteria) [55178] (1 protein) has a RRF/tRNA synthetase additional domain-like fold |
| Protein Ribosomal protein S4 [55179] (3 species) also contains a Zn-binding N-terminal subdomain |
| Species Thermus thermophilus [TaxId:274] [55180] (45 PDB entries) |
| Domain d2j02d1: 2j02 D:2-209 [137868] Other proteins in same PDB: d2j02b1, d2j02c1, d2j02c2, d2j02e1, d2j02e2, d2j02f1, d2j02g1, d2j02h1, d2j02i1, d2j02j1, d2j02k1, d2j02l1, d2j02m1, d2j02n1, d2j02o1, d2j02p1, d2j02q1, d2j02r1, d2j02s1, d2j02t1, d2j02u1 protein/RNA complex; complexed with mg, par, zn protein/RNA complex; complexed with mg, par, zn |
PDB Entry: 2j02 (more details), 2.8 Å
SCOPe Domain Sequences for d2j02d1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2j02d1 d.66.1.2 (D:2-209) Ribosomal protein S4 {Thermus thermophilus [TaxId: 274]}
gryigpvcrlcrregvklylkgercyspkcamerrpyppgqhgqkrarrpsdyavrlrek
qklrriygiserqfrnlfeeaskkkgvtgsvflgllesrldnvvyrlgfavsrrqarqlv
rhghitvngrrvdlpsyrvrpgdeiavaeksrnlelirqnleamkgrkvgpwlsldvegm
kgkflrlpdredlalpvneqlviefysr
Timeline for d2j02d1: