Lineage for d2j02b1 (2j02 B:7-241)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2855423Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2858664Superfamily c.23.15: Ribosomal protein S2 [52313] (1 family) (S)
    fold elaborated with additional structures
  5. 2858665Family c.23.15.1: Ribosomal protein S2 [52314] (1 protein)
  6. 2858666Protein Ribosomal protein S2 [52315] (3 species)
  7. 2858703Species Thermus thermophilus [TaxId:274] [52316] (46 PDB entries)
    Uniprot P80371
  8. 2858721Domain d2j02b1: 2j02 B:7-241 [137865]
    Other proteins in same PDB: d2j02c1, d2j02c2, d2j02d1, d2j02e1, d2j02e2, d2j02f1, d2j02g1, d2j02h1, d2j02i1, d2j02j1, d2j02k1, d2j02l1, d2j02m1, d2j02n1, d2j02o1, d2j02p1, d2j02q1, d2j02r1, d2j02s1, d2j02t1, d2j02u1
    protein/RNA complex; complexed with mg, par, zn
    protein/RNA complex; complexed with mg, par, zn

Details for d2j02b1

PDB Entry: 2j02 (more details), 2.8 Å

PDB Description: Structure of the Thermus thermophilus 70S ribosome complexed with mRNA, tRNA and paromomycin (part 3 of 4). This file contains the 30s subunit, mrna, a-, p- and e-site trnas and paromomycin for molecule II.
PDB Compounds: (B:) 30S ribosomal protein S2

SCOPe Domain Sequences for d2j02b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2j02b1 c.23.15.1 (B:7-241) Ribosomal protein S2 {Thermus thermophilus [TaxId: 274]}
vkelleagvhfgherkrwnpkfaryiyaerngihiidlqktmeelertfrfiedlamrgg
tilfvgtkkqaqdivrmeaeragmpyvnqrwlggmltnfktisqrvhrleelealfaspe
ieerpkkeqvrlkhelerlqkylsgfrllkrlpdaifvvdptkeaiavrearklfipvia
ladtdsdpdlvdyiipgnddairsiqlilsravdliiqarggvvepspsyalvqe

SCOPe Domain Coordinates for d2j02b1:

Click to download the PDB-style file with coordinates for d2j02b1.
(The format of our PDB-style files is described here.)

Timeline for d2j02b1: