Lineage for d2j01i1 (2j01 I:56-146)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 730576Fold d.99: Ribosomal protein L9 C-domain [55652] (1 superfamily)
    alpha-beta-alpha(2)-beta(2); 2 layers: alpha/beta
  4. 730577Superfamily d.99.1: Ribosomal protein L9 C-domain [55653] (1 family) (S)
  5. 730578Family d.99.1.1: Ribosomal protein L9 C-domain [55654] (1 protein)
  6. 730579Protein Ribosomal protein L9 C-domain [55655] (2 species)
  7. 730586Species Thermus thermophilus [TaxId:274] [143635] (2 PDB entries)
  8. 730587Domain d2j01i1: 2j01 I:56-146 [137862]
    Other proteins in same PDB: d2j0111, d2j0121, d2j01c1, d2j01i2, d2j01o1

Details for d2j01i1

PDB Entry: 2j01 (more details), 2.8 Å

PDB Description: Structure of the Thermus thermophilus 70S ribosome complexed with mRNA, tRNA and paromomycin (PART 2 of 4). This file contains the 50S subunit from molecule I.
PDB Compounds: (I:) 50S ribosomal protein L9

SCOP Domain Sequences for d2j01i1:

Sequence, based on SEQRES records: (download)

>d2j01i1 d.99.1.1 (I:56-146) Ribosomal protein L9 C-domain {Thermus thermophilus [TaxId: 274]}
krlaerkaeaerlkeilenltltipvragetkiygsvtakdiaealsrqhgvtidpkrla
lekpikelgeyvltykphpevpiqlkvsvva

Sequence, based on observed residues (ATOM records): (download)

>d2j01i1 d.99.1.1 (I:56-146) Ribosomal protein L9 C-domain {Thermus thermophilus [TaxId: 274]}
krlaerkaeaerlkeilenltltipvragetkiygsvtakdiaealsrqhgvtidpkrla
lekpikelgeyvltykphpevpiqlkvsvvv

SCOP Domain Coordinates for d2j01i1:

Click to download the PDB-style file with coordinates for d2j01i1.
(The format of our PDB-style files is described here.)

Timeline for d2j01i1: