Lineage for d2j00s1 (2j00 S:4-82)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1408957Fold d.28: Ribosomal protein S19 [54569] (1 superfamily)
    alpha-beta-X-beta(2); 2 layers: alpha/beta; mixed beta-sheet, order: 123
  4. 1408958Superfamily d.28.1: Ribosomal protein S19 [54570] (1 family) (S)
    automatically mapped to Pfam PF00203
  5. 1408959Family d.28.1.1: Ribosomal protein S19 [54571] (1 protein)
  6. 1408960Protein Ribosomal protein S19 [54572] (2 species)
  7. 1408988Species Thermus thermophilus [TaxId:274] [54573] (38 PDB entries)
    Uniprot P80381
  8. 1409003Domain d2j00s1: 2j00 S:4-82 [137857]
    Other proteins in same PDB: d2j00b1, d2j00c1, d2j00c2, d2j00d1, d2j00e1, d2j00e2, d2j00f1, d2j00g1, d2j00h1, d2j00i1, d2j00j1, d2j00k1, d2j00l1, d2j00m1, d2j00n1, d2j00o1, d2j00p1, d2j00q1, d2j00r1, d2j00t1, d2j00u1
    automatically matched to d1fjgs_
    protein/RNA complex; complexed with mg, par, zn

Details for d2j00s1

PDB Entry: 2j00 (more details), 2.8 Å

PDB Description: Structure of the Thermus thermophilus 70S ribosome complexed with mRNA, tRNA and paromomycin (part 1 of 4). This file contains the 30s subunit, mrna, a-, p- and e-site trnas and paromomycin for molecule I.
PDB Compounds: (S:) 30S ribosomal protein S19

SCOPe Domain Sequences for d2j00s1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2j00s1 d.28.1.1 (S:4-82) Ribosomal protein S19 {Thermus thermophilus [TaxId: 274]}
slkkgvfvddhllekvlelnakgekrliktwsrrstivpemvghtiavyngkqhvpvyit
enmvghklgefaptrtyrg

SCOPe Domain Coordinates for d2j00s1:

Click to download the PDB-style file with coordinates for d2j00s1.
(The format of our PDB-style files is described here.)

Timeline for d2j00s1: