Lineage for d2j00o1 (2j00 O:2-89)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1082369Fold a.16: S15/NS1 RNA-binding domain [47059] (1 superfamily)
    3 helices; irregular array
  4. 1082370Superfamily a.16.1: S15/NS1 RNA-binding domain [47060] (3 families) (S)
  5. 1082403Family a.16.1.2: Ribosomal protein S15 [47064] (1 protein)
    contains additional N-terminal helix that forms a separate unit
  6. 1082404Protein Ribosomal protein S15 [47065] (3 species)
  7. 1082418Species Thermus thermophilus [TaxId:274] [47067] (42 PDB entries)
    Uniprot P80378
  8. 1082436Domain d2j00o1: 2j00 O:2-89 [137853]
    Other proteins in same PDB: d2j00b1, d2j00c1, d2j00c2, d2j00d1, d2j00e1, d2j00e2, d2j00f1, d2j00g1, d2j00h1, d2j00i1, d2j00j1, d2j00k1, d2j00l1, d2j00m1, d2j00n1, d2j00p1, d2j00q1, d2j00r1, d2j00s1, d2j00t1, d2j00u1
    automatically matched to d1ab3__
    protein/RNA complex; complexed with mg, par, zn

Details for d2j00o1

PDB Entry: 2j00 (more details), 2.8 Å

PDB Description: Structure of the Thermus thermophilus 70S ribosome complexed with mRNA, tRNA and paromomycin (part 1 of 4). This file contains the 30s subunit, mrna, a-, p- and e-site trnas and paromomycin for molecule I.
PDB Compounds: (O:) 30S ribosomal protein S15

SCOPe Domain Sequences for d2j00o1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2j00o1 a.16.1.2 (O:2-89) Ribosomal protein S15 {Thermus thermophilus [TaxId: 274]}
pitkeekqkviqefarfpgdtgstevqvalltlrinrlsehlkvhkkdhhshrgllmmvg
qrrrllrylqredperyralieklgirg

SCOPe Domain Coordinates for d2j00o1:

Click to download the PDB-style file with coordinates for d2j00o1.
(The format of our PDB-style files is described here.)

Timeline for d2j00o1: