![]() | Class g: Small proteins [56992] (90 folds) |
![]() | Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily) alpha+beta metal(zinc)-bound fold |
![]() | Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (18 families) ![]() |
![]() | Family g.39.1.7: Ribosomal protein S14 [57752] (1 protein) |
![]() | Protein Ribosomal protein S14 [57753] (2 species) |
![]() | Species Thermus thermophilus [TaxId:274] [57754] (45 PDB entries) Uniprot P24320 |
![]() | Domain d2j00n1: 2j00 N:2-61 [137852] Other proteins in same PDB: d2j00b1, d2j00c1, d2j00c2, d2j00d1, d2j00e1, d2j00e2, d2j00f1, d2j00g1, d2j00h1, d2j00i1, d2j00j1, d2j00k1, d2j00l1, d2j00m1, d2j00o1, d2j00p1, d2j00q1, d2j00r1, d2j00s1, d2j00t1, d2j00u1 automatically matched to d1fjgn_ complexed with 5mu, mg, par, zn |
PDB Entry: 2j00 (more details), 2.8 Å
SCOP Domain Sequences for d2j00n1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2j00n1 g.39.1.7 (N:2-61) Ribosomal protein S14 {Thermus thermophilus [TaxId: 274]} arkaliekakrtpkfkvraytrcvrcgrarsvyrffglcriclrelahkgqlpgvrkasw
Timeline for d2j00n1: