Lineage for d2j00i1 (2j00 I:2-128)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 716671Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
    core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover
  4. 716672Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (12 families) (S)
  5. 716673Family d.14.1.1: Translational machinery components [54212] (4 proteins)
  6. 716753Protein Ribosomal protein S9 [54218] (1 species)
  7. 716754Species Thermus thermophilus [TaxId:274] [54219] (29 PDB entries)
  8. 716763Domain d2j00i1: 2j00 I:2-128 [137847]
    Other proteins in same PDB: d2j00b1, d2j00c1, d2j00c2, d2j00d1, d2j00e1, d2j00e2, d2j00f1, d2j00g1, d2j00h1, d2j00j1, d2j00k1, d2j00l1, d2j00m1, d2j00n1, d2j00o1, d2j00p1, d2j00q1, d2j00r1, d2j00s1, d2j00t1
    automatically matched to d1fjgi_
    complexed with 5mu, mg, par, zn

Details for d2j00i1

PDB Entry: 2j00 (more details), 2.8 Å

PDB Description: Structure of the Thermus thermophilus 70S ribosome complexed with mRNA, tRNA and paromomycin (part 1 of 4). This file contains the 30s subunit, mrna, a-, p- and e-site trnas and paromomycin for molecule I.
PDB Compounds: (I:) 30S ribosomal protein S9

SCOP Domain Sequences for d2j00i1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2j00i1 d.14.1.1 (I:2-128) Ribosomal protein S9 {Thermus thermophilus [TaxId: 274]}
eqyygtgrrkeavarvflrpgngkvtvngqdfneyfqglvravaaleplravdalgrfda
yitvrgggksgqidaiklgiaralvqynpdyraklkplgfltrdarvverkkygkhkarr
apqyskr

SCOP Domain Coordinates for d2j00i1:

Click to download the PDB-style file with coordinates for d2j00i1.
(The format of our PDB-style files is described here.)

Timeline for d2j00i1: