Lineage for d2j00g1 (2j00 G:2-156)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1274376Fold a.75: Ribosomal protein S7 [47972] (1 superfamily)
    core: 5 helices; contains one more helix and a beta-hairpin outside the core
  4. 1274377Superfamily a.75.1: Ribosomal protein S7 [47973] (1 family) (S)
  5. 1274378Family a.75.1.1: Ribosomal protein S7 [47974] (1 protein)
  6. 1274379Protein Ribosomal protein S7 [47975] (4 species)
  7. 1274409Species Thermus thermophilus [TaxId:274] [47977] (47 PDB entries)
    Uniprot P17291
  8. 1274427Domain d2j00g1: 2j00 G:2-156 [137845]
    Other proteins in same PDB: d2j00b1, d2j00c1, d2j00c2, d2j00d1, d2j00e1, d2j00e2, d2j00f1, d2j00h1, d2j00i1, d2j00j1, d2j00k1, d2j00l1, d2j00m1, d2j00n1, d2j00o1, d2j00p1, d2j00q1, d2j00r1, d2j00s1, d2j00t1, d2j00u1
    automatically matched to d1fjgg_
    protein/RNA complex; complexed with mg, par, zn

Details for d2j00g1

PDB Entry: 2j00 (more details), 2.8 Å

PDB Description: Structure of the Thermus thermophilus 70S ribosome complexed with mRNA, tRNA and paromomycin (part 1 of 4). This file contains the 30s subunit, mrna, a-, p- and e-site trnas and paromomycin for molecule I.
PDB Compounds: (G:) 30S ribosomal protein S7

SCOPe Domain Sequences for d2j00g1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2j00g1 a.75.1.1 (G:2-156) Ribosomal protein S7 {Thermus thermophilus [TaxId: 274]}
arrrraevrqlqpdlvygdvlvtafinkimrdgkknlaarifydackiiqektgqeplkv
fkqavenvkprmevrsrrvgganyqvpmevsprrqqslalrwlvqaanqrperraavria
helmdaaegkggavkkkedvermaeanrayahyrw

SCOPe Domain Coordinates for d2j00g1:

Click to download the PDB-style file with coordinates for d2j00g1.
(The format of our PDB-style files is described here.)

Timeline for d2j00g1: