SCOP 1.73: Domain d2j00e1: 2j00 E:74-154

Lineage for d2j00e1 (2j00 E:74-154)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
   core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover

4. Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (12 families)

5. Family d.14.1.1: Translational machinery components [54212] (4 proteins)

6. Protein Ribosomal protein S5, C-terminal domain [54215] (2 species)

7. Species Thermus thermophilus [TaxId:274] [54217] (36 PDB entries)

8. Domain d2j00e1: 2j00 E:74-154 [137842]
   Other proteins in same PDB: d2j00b1, d2j00c1, d2j00c2, d2j00d1, d2j00e2, d2j00f1, d2j00g1, d2j00h1, d2j00i1, d2j00j1, d2j00k1, d2j00l1, d2j00m1, d2j00n1, d2j00o1, d2j00p1, d2j00q1, d2j00r1, d2j00s1, d2j00t1
   automatically matched to d1i94e1
   complexed with 5mu, mg, par, zn

Details for d2j00e1

PDB Entry: 2j00, 2.8 Å

PDB Description: Structure of the Thermus thermophilus 70S ribosome complexed with mRNA, tRNA and paromomycin (part 1 of 4). This file contains the 30s subunit, mrna, a-, p- and e-site trnas and paromomycin for molecule I.

PDB Compounds: (E:) 30S ribosomal protein S5

SCOP Domain Sequences for d2j00e1:

Sequence; same for both SEQRES and ATOM records:

>d2j00e1 d.14.1.1 (E:74-154) Ribosomal protein S5, C-terminal domain {Thermus thermophilus [TaxId: 274]}
gtipheievefgaskivlkpaapgtgviagavprailelagvtdiltkelgsrnpiniay
atmealrqlrtkadverlrkg

Timeline for d2j00e1:

• d2j00e1 is new in SCOP 1.73
  
• d2j00e1 appears in SCOP 1.75
  
• d2j00e1 appears in the current release, SCOPe 2.08