Lineage for d2j00d1 (2j00 D:2-209)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 726401Fold d.66: Alpha-L RNA-binding motif [55173] (1 superfamily)
    alpha(2)-beta(2)-loop-beta; 2 layers: alpha/beta
  4. 726402Superfamily d.66.1: Alpha-L RNA-binding motif [55174] (5 families) (S)
    common motif in otherwise different folds
  5. 726403Family d.66.1.2: Ribosomal protein S4 [55178] (1 protein)
    has a RRF/tRNA synthetase additional domain-like fold
  6. 726404Protein Ribosomal protein S4 [55179] (2 species)
    also contains a Zn-binding N-terminal subdomain
  7. 726408Species Thermus thermophilus [TaxId:274] [55180] (36 PDB entries)
  8. 726418Domain d2j00d1: 2j00 D:2-209 [137841]
    Other proteins in same PDB: d2j00b1, d2j00c1, d2j00c2, d2j00e1, d2j00e2, d2j00f1, d2j00g1, d2j00h1, d2j00i1, d2j00j1, d2j00k1, d2j00l1, d2j00m1, d2j00n1, d2j00o1, d2j00p1, d2j00q1, d2j00r1, d2j00s1, d2j00t1
    automatically matched to d1hnwd_
    complexed with 5mu, mg, par, zn

Details for d2j00d1

PDB Entry: 2j00 (more details), 2.8 Å

PDB Description: Structure of the Thermus thermophilus 70S ribosome complexed with mRNA, tRNA and paromomycin (part 1 of 4). This file contains the 30s subunit, mrna, a-, p- and e-site trnas and paromomycin for molecule I.
PDB Compounds: (D:) 30S ribosomal protein S4

SCOP Domain Sequences for d2j00d1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2j00d1 d.66.1.2 (D:2-209) Ribosomal protein S4 {Thermus thermophilus [TaxId: 274]}
gryigpvcrlcrregvklylkgercyspkcamerrpyppgqhgqkrarrpsdyavrlrek
qklrriygiserqfrnlfeeaskkkgvtgsvflgllesrldnvvyrlgfavsrrqarqlv
rhghitvngrrvdlpsyrvrpgdeiavaeksrnlelirqnleamkgrkvgpwlsldvegm
kgkflrlpdredlalpvneqlviefysr

SCOP Domain Coordinates for d2j00d1:

Click to download the PDB-style file with coordinates for d2j00d1.
(The format of our PDB-style files is described here.)

Timeline for d2j00d1: