Class a: All alpha proteins [46456] (284 folds) |
Fold a.31: Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit [47390] (1 superfamily) 4 helices; bundle, closed, right-handed twist |
Superfamily a.31.1: Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit [47391] (1 family) dimer of identical alpha-hairpin motifs |
Family a.31.1.1: Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit [47392] (2 proteins) |
Protein cAMP-dependent protein kinase type II regulatory subunit [47393] (1 species) |
Species Mouse (Mus musculus) [TaxId:10090] [47394] (6 PDB entries) |
Domain d2izyd1: 2izy D:6-46 [137833] automatically matched to d1l6ea_ |
PDB Entry: 2izy (more details), 2.2 Å
SCOP Domain Sequences for d2izyd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2izyd1 a.31.1.1 (D:6-46) cAMP-dependent protein kinase type II regulatory subunit {Mouse (Mus musculus) [TaxId: 10090]} qippgltellqgytvevlrqqppdlvdfaveyftrlrearr
Timeline for d2izyd1: