SCOPe 2.02: Domain d2izyc_: 2izy C:

Lineage for d2izyc_ (2izy C:)

1. Root: SCOPe 2.02

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.31: Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit [47390] (1 superfamily)
   4 helices; bundle, closed, right-handed twist

4. Superfamily a.31.1: Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit [47391] (1 family)
   dimer of identical alpha-hairpin motifs

5. Family a.31.1.1: Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit [47392] (3 proteins)

6. Protein automated matches [190321] (3 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [187154] (1 PDB entry)

8. Domain d2izyc_: 2izy C: [137832]
   automated match to d1l6ea_

Details for d2izyc_

PDB Entry: 2izy, 2.2 Å

PDB Description: molecular basis of akap specificity for pka regulatory subunits

PDB Compounds: (C:) camp-dependent protein kinase regulatory subunit II

SCOPe Domain Sequences for d2izyc_:

Sequence; same for both SEQRES and ATOM records:

>d2izyc_ a.31.1.1 (C:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
qippgltellqgytvevlrqqppdlvdfaveyftrlrearrglehh

Timeline for d2izyc_:

• d2izyc_ first appeared in SCOP 1.73, called d2izyc1
  
• d2izyc_ appears in SCOPe 2.01
  
• d2izyc_ appears in SCOPe 2.03
  
• d2izyc_ appears in the current release, SCOPe 2.08, called d2izyc2