Lineage for d2izya_ (2izy A:)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 913472Fold a.31: Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit [47390] (1 superfamily)
    4 helices; bundle, closed, right-handed twist
  4. 913473Superfamily a.31.1: Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit [47391] (1 family) (S)
    dimer of identical alpha-hairpin motifs
  5. 913474Family a.31.1.1: Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit [47392] (3 proteins)
  6. 913492Protein automated matches [190321] (3 species)
    not a true protein
  7. 913496Species Mouse (Mus musculus) [TaxId:10090] [187154] (1 PDB entry)
  8. 913497Domain d2izya_: 2izy A: [137830]
    automated match to d1l6ea_

Details for d2izya_

PDB Entry: 2izy (more details), 2.2 Å

PDB Description: molecular basis of akap specificity for pka regulatory subunits
PDB Compounds: (A:) camp-dependent protein kinase regulatory subunit II

SCOPe Domain Sequences for d2izya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2izya_ a.31.1.1 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
qippgltellqgytvevlrqqppdlvdfaveyftrlrearrglehhh

SCOPe Domain Coordinates for d2izya_:

Click to download the PDB-style file with coordinates for d2izya_.
(The format of our PDB-style files is described here.)

Timeline for d2izya_: